PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000759612
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 342aa    MW: 39116.8 Da    PI: 5.5424
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000759612genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM58.52.2e-18251581128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.....leleevikevdiy.kvePwdLpkkvka...eekewyfFskrdkkyatgkrknr.atksgyWkat 86 
                    +p GfrF Ptd++l++++L ++v +++     ++ ++ i e+d++ k+ Pw   +++++   + +++yfF++ ++++  + r +r + + g+W+++
  MDP0000759612  25 MPLGFRFXPTDQDLISFFLYHRVLHREslmayCNNFKLIYEFDLFgKTSPWVVWENFSGpclDGQDLYFFCQLKNRS--EARIKReIDAGGTWSES 118
                    699*********************99989888666789****986478*****7544444557789******98875..568888556689***88 PP

            NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++     ++++ +g k+ L + k  +   +  dW+++ey++
  MDP0000759612 119 NSKLVKDLQNEKPIGKKRNLRYEK--EGCEHDGDWLLEEYSI 158
                    7754444458999*********84..4444589*******85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-2017183IPR003441NAC domain
PROSITE profilePS5100522.56725184IPR003441NAC domain
PfamPF023652.6E-1426158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEEEGYGGIV PMGFYENPLL GSNGMPLGFR FXPTDQDLIS FFLYHRVLHR ESLMAYCNNF  60
KLIYEFDLFG KTSPWVVWEN FSGPCLDGQD LYFFCQLKNR SEARIKREID AGGTWSESNS  120
KLVKDLQNEK PIGKKRNLRY EKEGCEHDGD WLLEEYSILP SVVGGADDSD HEIGKVVLCR  180
LKKNSRSGNK KNCSNSTQHV NEEWAKKRAR KEVKEKPVKK RARKEVKEKP VKKRARKEAN  240
EKPAKTKARN DVGSQNTTSM IAHTIDENNY KMISDATNDD QQCISNMDCS TMPANFSDHD  300
YVPISLVSEG GEPLLKDEDF LFENSEEMFF DLDDLFAPLD L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339049.10.0PREDICTED: NAC domain-containing protein 19-like
TrEMBLM5W3I19e-60M5W3I1_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12591634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.15e-11NAC domain containing protein 94